PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA39G00089
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 232aa    MW: 27090.6 Da    PI: 10.5562
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA39G00089genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.65.8e-18449147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ede+l ++v+q+G+++W++Ia+++  gR++k+c++rw++ 
       AA39G00089  4 RGHWRPAEDEKLRELVQQFGPHNWNAIAQKLS-GRSGKSCRLRWFNQ 49
                     899*****************************.***********996 PP

2Myb_DNA-binding55.31.5e-175699146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     r+++++eE+e+l+  ++ +G++ W++Iar ++ gRt++ +k++w+ 
       AA39G00089 56 RNPFSEEEEERLLASHRIHGNR-WSAIARFFP-GRTDNAVKNHWHV 99
                     789*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.748154IPR017930Myb domain
SMARTSM007171.4E-14352IPR001005SANT/Myb domain
SuperFamilySSF466897.49E-30497IPR009057Homeodomain-like
PfamPF002496.3E-17449IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.9E-27557IPR009057Homeodomain-like
CDDcd001671.15E-12748No hitNo description
PROSITE profilePS5129418.66255105IPR017930Myb domain
SMARTSM007171.6E-1555103IPR001005SANT/Myb domain
PfamPF002491.4E-145698IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.6E-2158103IPR009057Homeodomain-like
CDDcd001672.26E-115898No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MCSRGHWRPA EDEKLRELVQ QFGPHNWNAI AQKLSGRSGK SCRLRWFNQL DPRINRNPFS  60
EEEEERLLAS HRIHGNRWSA IARFFPGRTD NAVKNHWHVI MARRGRERSK IRRYSLPFNG  120
SNPKQTMITP YNEQNNTKLA STASTATATA RNAITYPYQF SHINHLQFLK ELLIGRMNER  180
KKPIEFYNFL QVKTDSNKFG TLNDSTKEEE NVVHKENCVT FIDFLSLGNS IS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C8e-3211041104C-Myb DNA-Binding Domain
1msf_C8e-3211041104C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00145DAPTransfer from AT1G17950Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013651779.11e-111PREDICTED: transcriptional activator Myb-like
RefseqXP_013681197.11e-111PREDICTED: transcriptional activator Myb-like
TrEMBLQ6R0C41e-110Q6R0C4_ARATH; MYB transcription factor
TrEMBLQ9LMT51e-110Q9LMT5_ARATH; F2H15.17 protein
TrEMBLR0ID701e-110R0ID70_9BRAS; Uncharacterized protein
STRINGAT1G17950.11e-110(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28182769
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.11e-111myb domain protein 52